Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GTPBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | GTPBP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15764820
|
Novus Biologicals
NBP15764820UL |
20 μL |
Each for $152.22
|
|
NBP157648
|
Novus Biologicals
NBP157648 |
100 μL |
Each for $436.00
|
|
Description
GTPBP2 Polyclonal specifically detects GTPBP2 in Human samples. It is validated for Western Blot.Specifications
| GTPBP2 | |
| Polyclonal | |
| Rabbit | |
| Q9BX10 | |
| 54676 | |
| Synthetic peptides corresponding to GTPBP2(GTP binding protein 2) The peptide sequence was selected from the N terminal of GTPBP2. Peptide sequence GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| GTP binding protein 2, GTP-binding protein 2, MGC74725 | |
| GTPBP2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title