Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GTPBP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15313020UL

 View more versions of this product

Catalog No. NBP15313020


Add to cart

Description

Description

GTPBP4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

GTPBP4
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GTPBP4
Synthetic peptides corresponding to GTPBP4(GTP binding protein 4) The peptide sequence was selected from the C terminal of GTPBP4. Peptide sequence MVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR.
74 kDa
20ul
Signal Transduction
Primary
23560
Western Blot
Western Blot 1:100-1:2000
Q9BZE4
Chronic renal failure gene protein, CRFGGTP-binding protein NGB, FLJ10686, FLJ10690, G protein-binding protein CRFG, GTP binding protein 4, NGB, NOG1FLJ39774, nucleolar GTP-binding protein 1
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit