GTPBP9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157453

Catalog No. NBP157453

Description

GTPBP9 Polyclonal specifically detects GTPBP9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GTPBP9
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9NTK5
• Gene Symbols: OLA1
• Immunogen: Synthetic peptides corresponding to GTPBP9 (GTP-binding protein 9 (putative)) The peptide sequence was selected from the N terminal of GTPBP9. Peptide sequence MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND.
• Quantity: 100 μL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 29789
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp313H1942, DNA damage-regulated overexpressed in cancer 45 protein, DOC45, EC 3.6.3, EC 3.6.3.-, GBP45, GTP-binding protein 9, GTP-binding protein 9 (putative), GTP-binding protein PTD004, GTPBP9, homologous yeast-44.2 protein, Obg-like ATPase 1, PTD004
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Xenopus: 100%; Western clawed frog: 100%; Chicken: 100%; Sumatran orangutan: 100%; Green puffer: 100%; Bovine: 100%; Mouse: 100%; Atlantic salmon: 92%; Rainbow smelt: 92%; Zebrafish: 92%; Fruit fly: 85%; Argulus sp. Arg2: 85%; Southern house mosquito: 78%; Pea aphid: 78%; Hanseniella sp. 'Han2': 78%; Orchesella imitari: 78%; Tomocerus sp. 'Tom2': 78%; Savannah tsetse fly: 78%; African malaria mosquito: 78%; Giant whipscorpion: 78%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified