Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GTPBP9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | GTPBP9 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157453
|
Novus Biologicals
NBP157453 |
100 μL |
Each of 1 for $436.00
|
|
Description
GTPBP9 Polyclonal specifically detects GTPBP9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
GTPBP9 | |
Polyclonal | |
Purified | |
RUO | |
Q9NTK5 | |
29789 | |
Synthetic peptides corresponding to GTPBP9 (GTP-binding protein 9 (putative)) The peptide sequence was selected from the N terminal of GTPBP9. Peptide sequence MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp313H1942, DNA damage-regulated overexpressed in cancer 45 protein, DOC45, EC 3.6.3, EC 3.6.3.-, GBP45, GTP-binding protein 9, GTP-binding protein 9 (putative), GTP-binding protein PTD004, GTPBP9, homologous yeast-44.2 protein, Obg-like ATPase 1, PTD004 | |
OLA1 | |
IgG | |
Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title