Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GTSE1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | GTSE1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158192
|
Novus Biologicals
NBP158192 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
GTSE1 Polyclonal specifically detects GTSE1 in Human samples. It is validated for Western Blot.Specifications
| GTSE1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| B99, G2 and S phase-expressed protein 1, G-2 and S-phase expressed 1, GTSE-1, Protein B99 homolog | |
| GTSE1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NYZ3 | |
| 51512 | |
| Synthetic peptides corresponding to GTSE1(G-2 and S-phase expressed 1) The peptide sequence was selected from the middle region of GTSE1. Peptide sequence IDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title