Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GUF1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17968320UL

 View more versions of this product

Catalog No. NBP17968320


Add to cart

Description

Description

GUF1 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

GUF1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GUF1
Synthetic peptide directed towards the C terminal of human Guf1The immunogen for this antibody is Guf1. Peptide sequence YLFPLNEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNGNMV.
72 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Western Blot
Western Blot 1:1000
NP_766299
EC 3.6.5.-, EF-4, Elongation factor 4 homolog, FLJ13220, GTPase GUF1, GTPase of unknown function 1, GTP-binding protein GUF1 homolog, GUF1 GTPase homolog (S. cerevisiae), Ribosomal back-translocase, translation factor GUF1, mitochondrial
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
60558
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit