Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HADH Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15473220UL

 View more versions of this product

Catalog No. NBP15473220


Add to cart

Description

Description

HADH Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Western Blotting.
Specifications

Specifications

HADH
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
HADH
Synthetic peptides corresponding to HADH(hydroxyacyl-Coenzyme A dehydrogenase) The peptide sequence was selected from the C terminal of HADH. Peptide sequence YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG.
33 kDa
20ul
Core ESC Like Genes, Lipid and Metabolism, Stem Cell Markers
Primary
3033
Immunohistochemistry, Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry
Q16836
EC 1.1.1, EC 1.1.1.35, HADH1, HADHSChydroxyacyl-Coenzyme A dehydrogenase, HCDH, hydroxyacyl-CoA dehydrogenase, L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain, Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase, MGC8392, mitochondrial, MSCHAD, SCHADHHF4
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit