Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HAND2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17418520UL
Description
HAND2 Polyclonal specifically detects HAND2 in Human, Mouse samples. It is validated for Western Blot.Specifications
HAND2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Q61039 | |
HAND2 | |
Synthetic peptides corresponding to the C terminal of Hand2. Immunizing peptide sequence DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ. | |
Affinity Purified | |
RUO | |
9464 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
BHLHA26, bHLHa26MGC125303, dHAND, DHAND2, FLJ16260, heart and neural crest derivatives expressed 2, heart, autonomic nervous system and neural crestderivatives-expressed protein 2, Hed, MGC125304, Thing2 | |
Rabbit | |
24 kDa | |
20 μL | |
Primary | |
Human, Mouse | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title