Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HAND2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen HAND2
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17418520
View Documents
Novus Biologicals
NBP17418520UL
20 μL
Each for $152.22
Add to cart
 
NBP174185
View Documents
Novus Biologicals
NBP174185
100 μL
Each for $436.00
Add to cart
 
Description

Description

HAND2 Polyclonal specifically detects HAND2 in Human, Mouse samples. It is validated for Western Blot.
Specifications

Specifications

HAND2
Western Blot
Unconjugated
RUO
BHLHA26, bHLHa26MGC125303, dHAND, DHAND2, FLJ16260, heart and neural crest derivatives expressed 2, heart, autonomic nervous system and neural crestderivatives-expressed protein 2, Hed, MGC125304, Thing2
HAND2
IgG
Affinity Purified
24 kDa
Western Blot 1.0 ug/ml
Polyclonal
Rabbit
Q61039
9464
Synthetic peptides corresponding to the C terminal of Hand2. Immunizing peptide sequence DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit