Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HAND2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | HAND2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17418520
|
Novus Biologicals
NBP17418520UL |
20 μL |
Each for $152.22
|
|
NBP174185
|
Novus Biologicals
NBP174185 |
100 μL |
Each for $436.00
|
|
Description
HAND2 Polyclonal specifically detects HAND2 in Human, Mouse samples. It is validated for Western Blot.Specifications
| HAND2 | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| BHLHA26, bHLHa26MGC125303, dHAND, DHAND2, FLJ16260, heart and neural crest derivatives expressed 2, heart, autonomic nervous system and neural crestderivatives-expressed protein 2, Hed, MGC125304, Thing2 | |
| HAND2 | |
| IgG | |
| Affinity Purified | |
| 24 kDa |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Rabbit | |
| Q61039 | |
| 9464 | |
| Synthetic peptides corresponding to the C terminal of Hand2. Immunizing peptide sequence DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title