Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HAX-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15480020UL

 View more versions of this product

Catalog No. NBP15480020


Add to cart

Description

Description

HAX-1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

HAX-1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
HAX1
Synthetic peptides corresponding to HAX1(HCLS1 associated protein X-1) The peptide sequence was selected from the middle region of HAX1. Peptide sequence LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP.
31 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Immunohistochemistry, Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry
O00165
FLJ17042, FLJ93803, HAX-1, HCLS1 (and PKD2) associated protein, HCLS1 associated protein X-1, HCLS1-associated protein X-1, HCLSBP1, HS1 binding protein, HS1-associating protein X-1, HS1-binding protein 1, HS1BP1FLJ18492, HSP1BP-1, SCN3
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
10456
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit