Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HBG1/2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309322100UL
Description
HBG1/2 Polyclonal specifically detects HBG1/2 in Rat samples. It is validated for Western Blot.Specifications
HBG1/2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
abnormal hemoglobin, A-gamma globin, gamma A hemoglobin, gamma globin, Gamma-1-globin, gamma-2-globin, gamma-globin chain, G-gamma globin Paulinia, Hb F Agamma, hb F Ggamma, HBGA, HBGR, HBG-T1, HBG-T2, Hemoglobin gamma-1 chain, hemoglobin gamma-2 chain, Hemoglobin gamma-A chain, hemoglobin gamma-G chain, hemoglobin subunit gamma-1, hemoglobin subunit gamma-2, hemoglobin, gamma A, hemoglobin, gamma G, hemoglobin, gamma, regulator of, HSGGL1, methemoglobin, PRO2979, TNCY | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hbe1 (NP_001008890). Peptide sequence MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS | |
100 μg | |
Primary | |
Rat | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
3047 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction