Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HBG1/2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen HBG1/2
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123546
View Documents
Novus Biologicals
NBP30932225UL
25 μg N/A
NB123545
View Documents
Novus Biologicals
NBP309322100UL
100 μg N/A
Description

Description

HBG1/2 Polyclonal antibody specifically detects HBG1/2 in Rat samples. It is validated for Western Blot
Specifications

Specifications

HBG1/2
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
3047
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Rat
abnormal hemoglobin, A-gamma globin, gamma A hemoglobin, gamma globin, Gamma-1-globin, gamma-2-globin, gamma-globin chain, G-gamma globin Paulinia, Hb F Agamma, hb F Ggamma, HBGA, HBGR, HBG-T1, HBG-T2, Hemoglobin gamma-1 chain, hemoglobin gamma-2 chain, Hemoglobin gamma-A chain, hemoglobin gamma-G chain, hemoglobin subunit gamma-1, hemoglobin subunit gamma-2, hemoglobin, gamma A, hemoglobin, gamma G, hemoglobin, gamma, regulator of, HSGGL1, methemoglobin, PRO2979, TNCY
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hbe1 (NP_001008890). Peptide sequence MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit