Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HBS1L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152835

 View more versions of this product

Catalog No. NBP152835


Add to cart

Description

Description

HBS1L Polyclonal antibody specifically detects HBS1L in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence.
Specifications

Specifications

HBS1L
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
HBS1L
Synthetic peptides corresponding to HBS1L(HBS1-like (S. cerevisiae)) The peptide sequence was selected from the C terminal of HBS1L. Peptide sequence MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH.
22 kDa
100 ul
Signal Transduction
Primary
10767
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Immunofluorescence, Immunohistochemistry, Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunofluorescence
Q9Y450
DKFZp434g247, ERF3-similar protein, ERFSDKFZp686L13262, HBS1 (S. cerevisiae)-like, HBS1KIAA1038EF-1a, HBS1-like (S. cerevisiae), HBS1-like protein, Hsp70 subfamily B suppressor 1-like protein, HSPC276
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit