Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HCFC1R1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15307020UL

 View more versions of this product

Catalog No. NBP15307020


Add to Cart

Description

Description

HCFC1R1 Polyclonal specifically detects HCFC1R1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

HCFC1R1
Polyclonal
Western Blot 1:100-1:2000
Q9NWW0
HCFC1R1
Synthetic peptides corresponding to HCFC1R1(host cell factor C1 regulator 1 (XPO1 dependent)) The peptide sequence was selected from the middle region of HCFC1R1. Peptide sequence LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM.
Affinity Purified
RUO
54985
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ20568, HCF-1 beta-propeller interacting protein, HCF-1 beta-propeller-interacting protein, host cell factor C1 regulator 1, host cell factor C1 regulator 1 (XPO1 dependant), host cell factor C1 regulator 1 (XPO1 dependent), HPIPMGC99622, MGC70711
Rabbit
15 kDa
20 μL
Primary
Human
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit