Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HDDC3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | HDDC3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156806
|
Novus Biologicals
NBP156806 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
HDDC3 Polyclonal specifically detects HDDC3 in Human samples. It is validated for Western Blot.Specifications
| HDDC3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 374659 | |
| Synthetic peptides corresponding to HDDC3(HD domain containing 3) The peptide sequence was selected from the middle region of HDDC3. Peptide sequence TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| (ppGpp)ase, EC 3.1.7.2, guanosine-3'-5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1, HD domain containing 3, HD domain-containing protein 3, MESH1, Metazoan SpoT homolog 1, metazoan SpoT homolog-1, MGC45386, Penta-phosphate guanosine-3'-pyrophosphohydrolase | |
| HDDC3 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title