Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HDDC3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen HDDC3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156806
View Documents
Novus Biologicals
NBP156806
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

HDDC3 Polyclonal specifically detects HDDC3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

HDDC3
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
374659
Synthetic peptides corresponding to HDDC3(HD domain containing 3) The peptide sequence was selected from the middle region of HDDC3. Peptide sequence TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
(ppGpp)ase, EC 3.1.7.2, guanosine-3'-5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1, HD domain containing 3, HD domain-containing protein 3, MESH1, Metazoan SpoT homolog 1, metazoan SpoT homolog-1, MGC45386, Penta-phosphate guanosine-3'-pyrophosphohydrolase
HDDC3
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit