Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HDHD1A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | HDHD1A |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB124879
|
Novus Biologicals
NBP309989100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
HDHD1A Polyclonal specifically detects HDHD1A in Human samples. It is validated for Western Blot.Specifications
HDHD1A | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
DXF68S1E5'-PsiMPase, EC 3.1.3.n6, family with sequence similarity 16, member A, X-linked, GS1FAM16AX, haloacid dehalogenase-like hydrolase domain containing 1, haloacid dehalogenase-like hydrolase domain containing 1A, Haloacid dehalogenase-like hydrolase domain-containing protein 1, Haloacid dehalogenase-like hydrolase domain-containing protein 1A, HDHD1Apseudouridine-5'-monophosphatase, Protein GS1 | |
The immunogen is a synthetic peptide directed towards the middle region of human HDHD1 (NP_001129037.1). Peptide sequence FFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPN | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
8226 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title