Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HDJ2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191453

 View more versions of this product

Catalog No. NBP191453


Add to cart

Description

Description

HDJ2 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

HDJ2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
DNAJA1
Synthetic peptide directed towards the N terminal of human Dnaja1. Peptide sequence YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD.
44 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Xenopus: 78%; Chicken: 78%; Zebrafish: 79% yeast 79%.
Mouse
Western Blot
Western Blot 1:1000
NP_032324
dj-2, DjA1, DnaJ (Hsp40) homolog, subfamily A, member 1, dnaJ homolog subfamily A member 1, DnaJ protein homolog 2, DNAJ2, hDJ-2, HDJ2, Heat shock 40 kDa protein 4, Heat shock protein J2, heat shock protein, DNAJ-like 2, HSDJ, HSJ2, HSJ-2, HSPF4hdj-2, Human DnaJ protein 2, NEDD7, neural precursor cell expressed, developmentally down-regulated 7
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
3301
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit