Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HE2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP198296
Description
HE2 Polyclonal specifically detects HE2 in Human samples. It is validated for Western Blot.Specifications
HE2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
NP_001075021 | |
SPAG11A | |
The immunogen for this antibody is HE2 - N-terminal region. Peptide sequence LFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRT. | |
Affinity Purified | |
RUO | |
653423 | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EDDM2A, sperm associated antigen 11A | |
Rabbit | |
12 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title