Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HEATR4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179609
Description
HEATR4 Polyclonal specifically detects HEATR4 in Human samples. It is validated for Western Blot.Specifications
HEATR4 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
HEAT repeat containing 4, HEAT repeat-containing protein 4, MGC48595 | |
Rabbit | |
Affinity purified | |
RUO | |
399671 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_976054 | |
HEATR4 | |
Synthetic peptide directed towards the N terminal of human HEATR4The immunogen for this antibody is HEATR4. Peptide sequence VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%. | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction