Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HEATR4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | HEATR4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179609
|
Novus Biologicals
NBP179609 |
100 μL |
Each of 1 for $436.00
|
|
Description
HEATR4 Polyclonal specifically detects HEATR4 in Human samples. It is validated for Western Blot.Specifications
HEATR4 | |
Polyclonal | |
Rabbit | |
Human | |
NP_976054 | |
399671 | |
Synthetic peptide directed towards the N terminal of human HEATR4The immunogen for this antibody is HEATR4. Peptide sequence VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
HEAT repeat containing 4, HEAT repeat-containing protein 4, MGC48595 | |
HEATR4 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title