Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HECA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | HECA |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1581320
|
Novus Biologicals
NBP15811320UL |
20 μL |
Each for $152.22
|
|
NBP158113
|
Novus Biologicals
NBP158113 |
100 μL |
Each for $436.00
|
|
Description
HECA Polyclonal specifically detects HECA in Human samples. It is validated for Western Blot.Specifications
| HECA | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| Q9UBI9 | |
| 51696 | |
| Synthetic peptides corresponding to HECA(headcase homolog (Drosophila)) The peptide sequence was selected from the middle region of HECA. Peptide sequence HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| dJ225E12.1, HDCHHDC, HDCL, headcase homolog (Drosophila), headcase protein homolog, hHDC | |
| HECA | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title