Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HECA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen HECA
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1581320
View Documents
Novus Biologicals
NBP15811320UL
20 μL
Each for $152.22
Add to cart
 
NBP158113
View Documents
Novus Biologicals
NBP158113
100 μL
Each for $436.00
Add to cart
 
Description

Description

HECA Polyclonal specifically detects HECA in Human samples. It is validated for Western Blot.
Specifications

Specifications

HECA
Polyclonal
Rabbit
Cell Cycle and Replication
Q9UBI9
51696
Synthetic peptides corresponding to HECA(headcase homolog (Drosophila)) The peptide sequence was selected from the middle region of HECA. Peptide sequence HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
dJ225E12.1, HDCHHDC, HDCL, headcase homolog (Drosophila), headcase protein homolog, hHDC
HECA
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit