Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HECTD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen HECTD2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155080
View Documents
Novus Biologicals
NBP155080
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

HECTD2 Polyclonal specifically detects HECTD2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

HECTD2
Polyclonal
Rabbit
Q5U5R9
143279
Synthetic peptides corresponding to HECTD2(HECT domain containing 2) The peptide sequence was selected from the middle region of HECTD2. Peptide sequence ALMLLRPEEVEILVCGSPDLDMHALQRSTQYDGYAKTDLTIKYFWDVVLG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
EC 6.3.2.-, FLJ16050, FLJ37306, HECT domain containing 2, HECT domain-containing protein 2, probable E3 ubiquitin-protein ligase HECTD2
HECTD2
IgG
Affinity Purified
88 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit