Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179293

 View more versions of this product

Catalog No. NBP179293


Add to cart

Description

Description

Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Polyclonal antibody specifically detects Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
HS2ST1
Synthetic peptide directed towards the N terminal of human HS2ST1 (NP_036394). Peptide sequence GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR.
Immunogen affinity purified
RUO
Primary
9653
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 0.2-1 ug/ml
Q7LGA3
2OST, 2-O-sulfotransferase, EC 2.8.2, EC 2.8.2.-, FLJ11317, heparan sulfate 2-O-sulfotransferase 1, HS2ST, KIAA0448dJ604K5.2, MGC131986
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Equine: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%.
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit