Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HERC4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen HERC4
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126038
View Documents
Novus Biologicals
NBP31056825UL
25 μg
Each for $106.19
Add to cart
 
NB126037
View Documents
Novus Biologicals
NBP310568100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

HERC4 Polyclonal antibody specifically detects HERC4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

HERC4
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Purified
RUO
PBS buffer, 2% sucrose
26091
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Unconjugated
Rabbit
Human
DKFZP564G092, EC 6.3.2, EC 6.3.2.-, HECT domain and RCC1-like domain-containing protein 4, hect domain and RLD 4, KIAA1593probable E3 ubiquitin-protein ligase HERC4
The immunogen is a synthetic peptide directed towards the middle region of human HERC4 (NP_071362). Peptide sequence LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSL
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit