Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

hHR23A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152942

 View more versions of this product

Catalog No. NBP152942

Add to cart



Rad23 Polyclonal antibody specifically detects Rad23 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).


PBS and 2% Sucrose with 0.09% Sodium Azide
Synthetic peptides corresponding to RAD23A(RAD23 homolog A (S. cerevisiae)) The peptide sequence was selected from the middle region of RAD23A. Peptide sequence GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ.
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Guinea pig: 92%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
hHR23A, HHR23ARAD23, yeast homolog, A, HR23A, MGC111083, RAD23 (S. cerevisiae) homolog A, RAD23 homolog A (S. cerevisiae), UV excision repair protein RAD23 homolog A
Apoptosis, Cancer, DNA Repair, Nucleotide Excision Repair, Tumor Suppressors
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit