Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HIATL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | HIATL1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179801
|
Novus Biologicals
NBP179801 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
HIATL1 Polyclonal specifically detects HIATL1 in Human samples. It is validated for Western Blot.Specifications
HIATL1 | |
Polyclonal | |
Rabbit | |
NP_115947 | |
84641 | |
Synthetic peptide directed towards the C terminal of human HIATL1The immunogen for this antibody is HIATL1. Peptide sequence GVQKHSNSSSGSLTNTPERGSDEDIEPLLQDSSIWELSSFEEPGNQCTEL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ14753, hippocampus abundant transcript-like 1, MGC117350 | |
HIATL1 | |
IgG | |
54 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title