Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HIC5/TGFB1I1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen HIC5/TGFB1I1
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125502
View Documents
Novus Biologicals
NBP31030025UL
25 μg
Each for $106.19
Add to cart
 
NB125501
View Documents
Novus Biologicals
NBP310300100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

HIC5/TGFB1I1 Polyclonal antibody specifically detects HIC5/TGFB1I1 in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

HIC5/TGFB1I1
Western Blot, Immunohistochemistry
Purified
RUO
Human
Androgen receptor coactivator 55 kDa protein, androgen receptor coactivator ARA55, Androgen receptor-associated protein of 55 kDa, ARA55Hydrogen peroxide-inducible clone 5 protein, HIC5, HIC-5, transforming growth factor beta 1 induced transcript 1, transforming growth factor beta-1-induced transcript 1 protein, TSC-5
The immunogen is a synthetic peptide directed towards the middle region of Human HIC5/TGFB1I1 (NP_057011). Peptide sequence PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Cell Cycle and Replication
PBS buffer, 2% sucrose
7041
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit