Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBE2K/E2-25K Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15491420UL

 View more versions of this product

Catalog No. NBP15491420


Add to cart

Description

Description

HIP2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

HIP2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
UBE2K
Synthetic peptides corresponding to HIP2(huntingtin interacting protein 2) The peptide sequence was selected from the N terminal of HIP2. Peptide sequence MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP.
22 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:100-1:2000
P61086
DKFZp564C1216, DKFZp686J24237, E2(25K), E2-25K, EC 6.3.2.19, HIP-2, HIP2LIG, huntingtin interacting protein 2, Huntingtin-interacting protein 2, HYPG, Ubiquitin carrier protein, ubiquitin-conjugating enzyme E2 K, Ubiquitin-conjugating enzyme E2(25K), Ubiquitin-conjugating enzyme E2-25 kDa, Ubiquitin-conjugating enzyme E2-25K, ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast), Ubiquitin-protein ligase
Rabbit
IgG
Protein A purified
RUO
Primary
3093
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit