Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HISPPD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15464220UL

 View more versions of this product

Catalog No. NBP15464220


Add to cart

Description

Description

HISPPD1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

HISPPD1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PPIP5K2
Synthetic peptides corresponding to HISPPD1(histidine acid phosphatase domain containing 1) The peptide sequence was selected from the middle region of HISPPD1. Peptide sequence SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV.
138 kDa
20ul
Protein Phosphatase
Primary
23262
Western Blot
Western Blot 1:100-1:2000
O43314
diphosphoinositol pentakisphosphate kinase 2FLJ21506, EC 2.7.4.21, EC 2.7.4.24, HISPPD1histidine acid phosphatase domain containing 1, Histidine acid phosphatase domain-containing protein 1, hsVIP2, inositol heptaphosphate kinase 2, inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2, InsP6 and PP-IP5 kinase 2, KIAA0433FLJ23463, VIP1 homolog 2, VIP2IP7K2
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit