Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Histidase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153135

 View more versions of this product

Catalog No. NBP153135


Add to cart

Description

Description

Histidase Polyclonal antibody specifically detects Histidase in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

Histidase
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
HAL
Synthetic peptides corresponding to HAL(histidine ammonia-lyase) The peptide sequence was selected from the N terminal of HAL. Peptide sequence INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET.
Immunogen affinity purified
RUO
Primary
3034
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1.25 ug/ml
P42357
EC 4.3.1, EC 4.3.1.3, HIS, Histidase, histidine ammonia-lyase, HSTD
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Xenopus: 92%; Canine: 92%; Pig: 92%; Chicken: 85%; Zebrafish: 85%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit