Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Histone H1T Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP257668

Catalog No. NBP257668


Add to cart

Description

Description

Histone H1T Polyclonal antibody specifically detects Histone H1T in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Histone H1T
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
dJ221C16.2, H1 histone family, member T (testis-specific), H1FTMGC163222, H1t, histone 1, H1t, histone cluster 1, H1t, histone H1t, Testicular H1 histone
Rabbit
IgG
100 ul
Epigenetics, Histones and Modified Histones
Primary
3010
Human
Immunohistochemistry (Paraffin)
Immunohistochemistry-Paraffin 1:1000 - 1:2500
Affinity Purified
HIST1H1T
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMS
Affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only