Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Histone H2AY/macroH2A.1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen Histone H2AY/macroH2A.1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15300320
View Documents
Novus Biologicals
NBP15300320UL
20 μL
Each for $152.22
Add to cart
 
NBP153003
View Documents
Novus Biologicals
NBP153003
100 μL
Each for $436.00
Add to cart
 
Description

Description

Histone H2AY/macroH2A.1 Polyclonal specifically detects Histone H2AY/macroH2A.1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Histone H2AY/macroH2A.1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
core histone macro-H2A.1, H2A histone family, member Y, H2A.y, H2A/y, H2AF12M, H2AFJ, Histone H2A.y, Histone macroH2A1, histone macroH2A1.1, histone macroH2A1.2, MACROH2A1, MACROH2A1.1, macroH2A1.2, Medulloblastoma antigen MU-MB-50.205, mH2A1
H2AFY
IgG
Affinity Purified
39 kDa
Western Blot
Unconjugated
RUO
O75367
9555
Synthetic peptides corresponding to H2AFY(H2A histone family, member Y) The peptide sequence was selected from the N terminal of H2AFY. Peptide sequence HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit