Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HLA B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen HLA B
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125091
View Documents
Novus Biologicals
NBP310095100UL
100 μg
Each for $352.89
Add to cart
 
NB125092
View Documents
Novus Biologicals
NBP31009525UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

HLA B Polyclonal antibody specifically detects HLA B in Human samples. It is validated for Western Blot
Specifications

Specifications

HLA B
Western Blot
Purified
RUO
Human
ankylosing spondylitis, AS, b'DT, Bw-22, Bw-4, Bw-41, Bw-44, Bw-45, Bw-46, Bw-47, Bw-48, Bw-50, Bw-52, Bw-53, Bw-54, Bw-55, Bw-56, Bw-57, Bw-58, Bw-60, HLA class I histocompatibility antigen, B alpha chain, HLA class I histocompatibility antigen, B-12 alpha chain, HLA class I histocompatibility antigen, B-21 alpha chain, HLA class I histocompatibility antigen, B-5 alpha chain, HLA class I histocompatibility antigen, B-7 alpha chain, HLAB, HLA-B27, HLA-B73, leukocyte antigen class I-B, lymphocyte antigen, major histocompatibility complex, class I, B, MGC111087, MHC class I antigen B*13, MHC class I antigen B*14, MHC class I antigen B*15, MHC class I antigen B*18, MHC class I antigen B*27, MHC class I antigen B*35, MHC class I antigen B*37, MHC class I antigen B*38, MHC class I antigen B*39, MHC class I antigen B*40, MHC class I antigen B*41, MHC class I antigen B*42, MHC class I antigen B*44, MHC class I antigen B*45, MHC class I antigen B*46, MHC class I antigen B*47, MHC class I anti
The immunogen is a synthetic peptide directed towards the middle region of human HLA B (XP_011545540.1). Peptide sequence TQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHH
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Adaptive Immunity, Immunology
PBS buffer, 2% sucrose
3106
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit