Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HLA DPA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | HLA DPA |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159051
|
Novus Biologicals
NBP159051 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
HLA DPA Polyclonal specifically detects HLA DPA in Human samples. It is validated for Western Blot.Specifications
| HLA DPA | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Asthma, Immunology | |
| P20036 | |
| 3113 | |
| Synthetic peptides corresponding to HLA-DPA1(major histocompatibility complex, class II, DP alpha 1) The peptide sequence was selected from the middle region of HLA-DPA1. Peptide sequence EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DP alpha 1 chain, HLA class II histocompatibility antigen, DP alpha chain, HLADP, HLA-SB alpha chain, major histocompatibility complex, class II, DP alpha 1, MHC class II antigen, MHC class II DP3-alpha, MHC class II DPA1, MHC class II HLA-DPA1 antigen, Primed lymphocyte test-1 | |
| HLA-DPA1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title