Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HLA DPA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody



Antigen HLA DPA
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
100 μL
Each of 1 for $436.00
Add to cart


HLA DPA Polyclonal specifically detects HLA DPA in Human samples. It is validated for Western Blot.


Adaptive Immunity, Asthma, Immunology
Synthetic peptides corresponding to HLA-DPA1(major histocompatibility complex, class II, DP alpha 1) The peptide sequence was selected from the middle region of HLA-DPA1. Peptide sequence EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT.
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
PBS and 2% Sucrose with 0.09% Sodium Azide
DP alpha 1 chain, HLA class II histocompatibility antigen, DP alpha chain, HLADP, HLA-SB alpha chain, major histocompatibility complex, class II, DP alpha 1, MHC class II antigen, MHC class II DP3-alpha, MHC class II DPA1, MHC class II HLA-DPA1 antigen, Primed lymphocyte test-1
Affinity Purified
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit