Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HNF-4 gamma/NR2A2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | HNF-4 gamma/NR2A2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP152810
|
Novus Biologicals
NBP152810 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
HNF-4 gamma/NR2A2 Polyclonal specifically detects HNF-4 gamma/NR2A2 in Human samples. It is validated for Western Blot.Specifications
| HNF-4 gamma/NR2A2 | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| Q14541 | |
| 3174 | |
| Synthetic peptides corresponding to HNF4G(hepatocyte nuclear factor 4, gamma) The peptide sequence was selected from the C terminal of HNF4G (NP_004124). Peptide sequence QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| hepatocyte nuclear factor 4, gamma, hepatocyte nuclear factor 4-gamma, HNF-4-gamma, NR2A2Nuclear receptor subfamily 2 group A member 2, NR2A3 | |
| HNF4G | |
| IgG | |
| Affinity Purified | |
| 46 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title