Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HNF-6/ONECUT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19160720UL

 View more versions of this product

Catalog No. NBP19160720


Add to cart

Description

Description

HNF-6/ONECUT1 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Frozen), Western Blotting.
Specifications

Specifications

HNF-6/ONECUT1
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
ONECUT1
Synthetic peptide directed towards ONECUT1. Peptide sequence CKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITIS.
51 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500
NP_032288
HNF6Ahepatocyte nuclear factor 6, alpha, HNF6hepatocyte nuclear factor 6, HNF-6One cut domain family member 1, one cut homeobox 1one cut domain, family member 1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
3175
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit