HNF-6/ONECUT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP19160720UL

Catalog No. NBP19160720

Description

HNF-6/ONECUT1 Polyclonal specifically detects HNF-6/ONECUT1 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: HNF-6/ONECUT1
• Classification: Polyclonal
• Dilution: Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500
• Gene Accession No.: NP_032288
• Gene Symbols: ONECUT1
• Immunogen: Synthetic peptide directed towards ONECUT1. Peptide sequence CKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITIS.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3175
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: HNF6Ahepatocyte nuclear factor 6, alpha, HNF6hepatocyte nuclear factor 6, HNF-6One cut domain family member 1, one cut homeobox 1one cut domain, family member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 51 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Mouse
• Isotype: IgG