Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HNF-6/ONECUT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$204.00 - $482.50
Specifications
| Antigen | HNF-6/ONECUT1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19160720
|
Novus Biologicals
NBP19160720UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP191607
|
Novus Biologicals
NBP191607 |
100 μL |
Each for $482.50
|
|
|||||
Description
HNF-6/ONECUT1 Polyclonal specifically detects HNF-6/ONECUT1 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.Specifications
| HNF-6/ONECUT1 | |
| Unconjugated | |
| RUO | |
| HNF6Ahepatocyte nuclear factor 6, alpha, HNF6hepatocyte nuclear factor 6, HNF-6One cut domain family member 1, one cut homeobox 1one cut domain, family member 1 | |
| ONECUT1 | |
| IgG | |
| 51 kDa |
| Polyclonal | |
| Rabbit | |
| NP_032288 | |
| 3175 | |
| Synthetic peptide directed towards ONECUT1. Peptide sequence CKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITIS. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title