Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HNRNPA0 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | HNRNPA0 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15727520
|
Novus Biologicals
NBP15727520UL |
20 μL |
Each for $152.22
|
|
NBP157275
|
Novus Biologicals
NBP157275 |
100 μL |
Each for $436.00
|
|
Description
HNRNPA0 Polyclonal specifically detects HNRNPA0 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
| HNRNPA0 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q13151 | |
| 10949 | |
| Synthetic peptides corresponding to HNRPA0 (heterogeneous nuclear ribonucleoprotein A0) The peptide sequence was selected from the middle region of HNRPA0. Peptide sequence KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| heterogeneous nuclear ribonucleoprotein A0, hnRNA binding protein, hnRNPA0, HNRPA0hnRNP A0 | |
| HNRNPA0 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title