Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HOXA9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310527100UL
Description
HOXA9 Polyclonal specifically detects HOXA9 in Human samples. It is validated for Western Blot.Specifications
HOXA9 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ABD-B, homeo box A9, homeobox A9, Homeobox protein Hox-1G, homeobox protein Hox-A9, homeobox protein HOXA9, homeodomain protein HOXA9, HOX1, HOX1.7, HOX1GMGC1934 | |
The immunogen is a synthetic peptide directed towards the middle region of human HOXA9 (NP_689952). Peptide sequence KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE | |
100 μg | |
Cancer | |
3205 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction