HOXC12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169214

Catalog No. NBP169214

Description

HOXC12 Polyclonal specifically detects HOXC12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HOXC12
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P31275
• Gene Symbols: HOXC12
• Immunogen: Synthetic peptides corresponding to HOXC12 (homeobox C12) The peptide sequence was selected from the C terminal of HOXC12. Peptide sequence NSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKI.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3228
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: HOC3F, homeo box 3F, homeo box C12, homeobox C12, Homeobox protein Hox-3F, homeobox protein Hox-C12, HOX3FHOX3
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Goat: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG