Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HOXC12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | HOXC12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP169214
|
Novus Biologicals
NBP169214 |
100 μL |
Each of 1 for $436.00
|
|
Description
HOXC12 Polyclonal specifically detects HOXC12 in Human samples. It is validated for Western Blot.Specifications
HOXC12 | |
Polyclonal | |
Rabbit | |
P31275 | |
3228 | |
Synthetic peptides corresponding to HOXC12 (homeobox C12) The peptide sequence was selected from the C terminal of HOXC12. Peptide sequence NSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKI. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
HOC3F, homeo box 3F, homeo box C12, homeobox C12, Homeobox protein Hox-3F, homeobox protein Hox-C12, HOX3FHOX3 | |
HOXC12 | |
IgG | |
Affinity Purified | |
30 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title