Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HOXC12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP168929
Description
HOXC12 Polyclonal specifically detects HOXC12 in Mouse samples. It is validated for Western Blot.Specifications
HOXC12 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
HOC3F, homeo box 3F, homeo box C12, homeobox C12, Homeobox protein Hox-3F, homeobox protein Hox-C12, HOX3FHOX3 | |
Rabbit | |
30 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8K5B8 | |
HOXC12 | |
Synthetic peptides corresponding to Hoxc12 (homeobox C12) The peptide sequence was selected from the N terminal of Hoxc12. Peptide sequence PLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNG. | |
Affinity purified | |
RUO | |
3228 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction