Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HOXC8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31051325UL

 View more versions of this product

Catalog No. NB125928


Add to cart

Description

Description

HOXC8 Polyclonal specifically detects HOXC8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

HOXC8
Unconjugated
PBS buffer, 2% sucrose
homeo box C8, homeobox C8, Homeobox protein Hox-3A, homeobox protein Hox-C8, HOX3, Hox-3.1, mouse, homolog of, HOX3Ahomeo box 3A
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC8 (NP_073149). Peptide sequence SHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGD
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Purified
Rabbit
Affinity purified
RUO
Primary
3224
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit