Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HP1BP3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | HP1BP3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155330
|
Novus Biologicals
NBP155330 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
HP1BP3 Polyclonal specifically detects HP1BP3 in Human samples. It is validated for Western Blot.Specifications
| HP1BP3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| heterochromatin protein 1, binding protein 3, heterochromatin protein 1-binding protein 3, HP1-BP74, MGC43701, Protein HP1-BP74 | |
| HP1BP3 | |
| IgG | |
| Affinity Purified | |
| 61 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5SSJ5 | |
| 50809 | |
| Synthetic peptides corresponding to HP1BP3(heterochromatin protein 1, binding protein 3) The peptide sequence was selected from the middle region of HP1BP3. Peptide sequence QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title