Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ HPSC152 Protein 1

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP192008PEP

Catalog No. NBP192008PE


Add to Cart

Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRMT112. The HPSC152 Recombinant Protein Antigen is derived from E. coli. The HPSC152 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

51504
Chromatography
0.5mg/mL
PBS and 1M Urea, pH 7.4.
TRMT112
25kDa
0.1mL
E.Coli
MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRL
Human
>80%
Store at -20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
Unlabeled
HPSC152
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92008. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Safety and Handling

Safety and Handling

ShelfLife : 365

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only