Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Hrk Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Hrk |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15944720
|
Novus Biologicals
NBP15944720UL |
20 μL |
Each for $152.22
|
|
NBP159447
|
Novus Biologicals
NBP159447 |
100 μL |
Each for $436.00
|
|
Description
Hrk Polyclonal specifically detects Hrk in Human samples. It is validated for Western Blot.Specifications
| Hrk | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| activator of apoptosis harakiri, activator of apoptosis Hrk, BCL2-interacting protein, BH3-interacting domain-containing protein 3, BID3, death protein 5, DP5, HARAKIRI, harakiri, BCL2 interacting protein (contains only BH3 domain), harakiri, BCL2-interacting protein (contains only BH3 domain), Neuronal death protein DP5 | |
| HRK | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O00198 | |
| 8739 | |
| Synthetic peptides corresponding to HRK(harakiri, BCL2 interacting protein (contains only BH3 domain)) The peptide sequence was selected from the N terminal of HRK. Peptide sequence MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title