Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HS747E2A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | HS747E2A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179704
|
Novus Biologicals
NBP179704 |
100 μL |
Each for $436.00
|
|
NBP17970420
|
Novus Biologicals
NBP17970420UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
HS747E2A Polyclonal specifically detects HS747E2A in Human samples. It is validated for Western Blot.Specifications
| HS747E2A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| NP_056185 | |
| 25770 | |
| Synthetic peptide directed towards the middle region of human C22orf31. Peptide sequence GKAIKQKLWEALCSQGAISEGAQRDRFPGRKQPGVHEEPVLKKWPKLKSK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| bK747E2.1, chromosome 22 open reading frame 31, HS747E2A, hypothetical protein LOC25770 | |
| C22ORF31 | |
| IgG | |
| Affinity Purified | |
| 33 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title