Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HS747E2A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen HS747E2A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179705
View Documents
Novus Biologicals
NBP179705
100 μL
Each for $436.00
Add to cart
 
NBP17970520
View Documents
Novus Biologicals
NBP17970520UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

HS747E2A Polyclonal specifically detects HS747E2A in Human samples. It is validated for Western Blot.
Specifications

Specifications

HS747E2A
Polyclonal
Rabbit
Human
NP_056185
25770
Synthetic peptide directed towards the N terminal of human C22orf31. Peptide sequence ASSFSLVKLVLRRQLKNKCCPPPCKFGEGKLSKRLKHKDDSVMKATQQAR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
bK747E2.1, chromosome 22 open reading frame 31, HS747E2A, hypothetical protein LOC25770
C22ORF31
IgG
Affinity Purified
33 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit