Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSCB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Specifications
Antigen | HSCB |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP184066
|
Novus Biologicals
NBP184066 |
0.1 mL |
Each of 1 for $627.50
|
N/A | |||||
Description
HSCB Polyclonal specifically detects HSCB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
HSCB | |
Polyclonal | |
Rabbit | |
metabolism | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
150274 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:QFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
DnaJ homolog subfamily C member 20, DNAJC20DnaJ (Hsp40) homolog, subfamily C, member 20, Hsc20, HSC20dJ366L4.2, HscB iron-sulfur cluster co-chaperone homolog (E. coli), iron-sulfur cluster co-chaperone protein HscB, mitochondrial, Jac1, J-type co-chaperone HSC20, MGC2637, MGC74462 | |
HSCB | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title