HSD17B8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184309

Catalog No. NBP184309

Description

HSD17B8 Polyclonal specifically detects HSD17B8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HSD17B8
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: D6S2245EdJ1033B10.9, EC 1.1.1.-, EC 1.1.1.62, EC 1.1.1.63,17-beta-HSD 8, estrogen 17-oxidoreductase, FABGLestradiol 17-beta-dehydrogenase 8, H2-KE6, HKE6FabG (beta-ketoacyl-[acyl-carrier-protein] reductase, E coli) like (E. coli), hydroxysteroid (17-beta) dehydrogenase 8,3-oxoacyl-[acyl-carrier-protein] reductase, ke-6, KE6, Ke-6,17-beta-hydroxysteroid dehydrogenase 8, Protein Ke6, Really interesting new gene 2 protein, RING2FABG, SDR30C1, short chain dehydrogenase/reductase family 30C, member 1, Testosterone 17-beta-dehydrogenase 8
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: HSD17B8
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY
• Quantity: 0.1 mL
• Research Discipline: metabolism
• Gene ID (Entrez): 7923
• Target Species: Human
• Isotype: IgG

For Research Use Only